This webpage opens when we perform identical sequence searching from the website https://chain-searching.herokuapp.com.
In identical searching, all the output FASTA sequences will contain the exact input sequence.
The output of the identical search contains 4 attributes, the key value which is the name or PDB name of that protein, the FASTA sequence, the URL of that which redirects to the page which contains information of that particular output and the database name from where it is fetched.
For example, Oxytocin is a peptide of nine amino acids.
The FASTA sequence of Oxytocin is CYIQNCPLG (Cysteine-Tyrosine-Isoleucine-Glutamine-Asparagine-Cysteine-Proline-Leucine-Glycine).
When this sequence is taken as input for the identical searching, it shows us 6 different identical FASTA sequences along with their key values and database name. This means that this same sequence will be present in all those 6 FASTA sequences.
For instance ACYIQNCPLGGKRAVLDLDVRKCIPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPS (oxytocin-neuroph-ysin 1) is one of the outputs.
NOTE: Opening this webpage directly will also display a form where you can search the sequence.
Input: An input form where we can input the string for identical searching
Output:The webpage which contains all the peptide names along with the FASTA sequences, URL and the database name from where it is fetched.
NOTE: All the searches are performed using the POST method
This webpage opens when we perform homologous sequence searching from the website https://chain-searching.herokuapp.com.
In homologous searching, the outputs have a relation with the input sequence which means they have a common ancestor.
Unlike identical searching, the output FASTA sequences in homologous searching may or may not contain the exact input sequences.
The output of the homologous search contains 5 attributes, the key value which is the name or PDB name of that protein, the FASTA sequence,
the URL of that which redirects to the page which contains information of that particular output and the database name from where it is fetched and the homologous sequence which it was flagged for.
NOTE: Opening this webpage directly will also display a form where you can search the sequence.
Input: An input form where we can input the string for homologous searching
Output:The webpage which contains all the peptide names to which the input is homologous, along with the FASTA sequences, URL and the database name from where it is fetched.
NOTE: All the searches are performed using the POST method
The dbSearch webpage allows the user to search a particular chain from the database of his/her choice.
They can also search from multiple databases available in the dropdown list, which is available after the user has entered the query chain, by selecting multiple databases (pressing control key/command key and selecting the databases for windows/Mac respectively).
NOTE: The query chain is not case sensitive.
Input: An input form where we can input the string for identical searching and then selecting the databases
Output:The webpage which contains all the identical peptides from those databases as selected
This opens the web API search page. AN input form is displayed where the user is asked to enter the chain that he/she wants to search the API for.
After entering the chain, the user is shown with two options asking whether he wants to perform identical or homologous searching.
NOTE: The query chain is not case sensitive..
Input: An input form where we can input the string for identical or homologous searching
Output:The webpage which contains all the peptide names along with the FASTA sequences, URL and the database name from where it is fetched in a JSON format
NOTE: All the searches are performed using the GET method
This webpage opens when we perform identical sequence searching from the website https://chain-searching.herokuapp.com/api_web.
For example if we input CYIQ for identical searching, the URL of this page will be https://chain-searching.herokuapp.com/identical-api/CYIQ .
The result will contain all the four attributes as in the case of '/identical'. The only difference is the format in which the output will be displayed to the user.
The output format in this webpage is:
[["peptide name 1","peptide name 2",...][{"chain of peptide 1","data-bank","key","url"},{"chain of peptide 2","data-bank","key","url"},....]]
Input: Direct input with the query chain in URL can be given as mentioned above
Output:The webpage which contains all the peptide names along with the FASTA sequences, URL and the database name from where it is fetched in a JSON format
NOTE: All the searches are performed using the GET method
This webpage opens when we perform homologous sequence searching from the website https://chain-searching.herokuapp.com/api_web.
For example if we input CYIQ for homologous searching, the URL of this page will be https://chain-searching.herokuapp.com/homologous-api/CYIQ .
The result will contain all the four attributes as in the case of '/homologous'. The only difference is the format in which the output will be displayed to the user.
The output format in this webpage is:
[["peptide name 1","peptide name 2",...][{"Chain of homologous sequence 1", "Data":[{FASTA sequence 1","data-bank","key of 1st FASTA sequence","url"},{FASTA sequence 2","data-bank","key of 2nd FASTA sequence","url"},....]},{"Chain of homologous sequence 2", "Data":[{FASTA sequence 1","data-bank","key of 1st FASTA sequence","url"},{FASTA sequence 2","data-bank","key of 2nd FASTA sequence","url"},....]}]]
Input: Direct input with the query chain in URL can be given as mentioned above
Output:The webpage which contains all the peptide names along with the FASTA sequences, URL and the database name from where it is fetched in a JSON format
NOTE: All the searches are performed using the GET method